(data stored in ACNUC7421 zone)

EMBL: CP001958.PE515

CP001958.PE515       Location/Qualifiers
FT   CDS             500223..500963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0524"
FT                   /product="transmembrane protein"
FT                   /note="KEGG: mmi:MMAR_2455 transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97008"
FT                   /db_xref="GOA:D6ZCG6"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCG6"
FT                   /inference="similar to AA sequence:KEGG:MMAR_2455"
FT                   /protein_id="ADG97008.1"
FT                   /translation="MTSLAQAAPLRWAARFPVTLCYVLGLAAVAFFQRGLSDARGQQLV
FT                   SQTSTNLRNLAEGRWLTLLESAFVTQEDPSRIWVWLPGFACLLALGEWIWRSRRLAGAI
FT                   VLSHVGGTALVALGLVVALRLGWAESSVVDDDDVGVSYASMGAFGALIGAVPRALRLPW
FT                   AAWWLAAAALALWRDRDFTSAGHLVSLCLGLMAGAWFARGGERTRWTPLMLCLAAVAFV
FT                   FSFDVLVDVRAFGFDPQAPAASPP"
     MTSLAQAAPL RWAARFPVTL CYVLGLAAVA FFQRGLSDAR GQQLVSQTST NLRNLAEGRW        60
     LTLLESAFVT QEDPSRIWVW LPGFACLLAL GEWIWRSRRL AGAIVLSHVG GTALVALGLV       120
     VALRLGWAES SVVDDDDVGV SYASMGAFGA LIGAVPRALR LPWAAWWLAA AALALWRDRD       180
     FTSAGHLVSL CLGLMAGAWF ARGGERTRWT PLMLCLAAVA FVFSFDVLVD VRAFGFDPQA       240
     PAASPP                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page