(data stored in ACNUC7421 zone)

EMBL: CP001958.PE517

CP001958.PE517       Location/Qualifiers
FT   CDS             complement(501574..502152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_3968 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97010"
FT                   /db_xref="GOA:D6ZCG8"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97010.1"
FT                   /translation="MAVTAFFDGTACGPAGAIRYDLRMIRLNLFFALLSLVLALAGPRG
FT                   YGLWGWWGLVAYLVGAVGSVGPWALGLIARIGVLERYDRLEPQFSKAAEALSVASVFIP
FT                   FLRAVNAMLAGVAFGAWLLNKRWLAQAAVLVATGLIALGGPLVQLAVGHRPIASANWAI
FT                   AAAPLAVMALWLLGRRFLRRQPAVRRPVR"
     MAVTAFFDGT ACGPAGAIRY DLRMIRLNLF FALLSLVLAL AGPRGYGLWG WWGLVAYLVG        60
     AVGSVGPWAL GLIARIGVLE RYDRLEPQFS KAAEALSVAS VFIPFLRAVN AMLAGVAFGA       120
     WLLNKRWLAQ AAVLVATGLI ALGGPLVQLA VGHRPIASAN WAIAAAPLAV MALWLLGRRF       180
     LRRQPAVRRP VR                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page