(data stored in ACNUC7421 zone)

EMBL: CP001958.PE520

CP001958.PE520       Location/Qualifiers
FT   CDS             504230..505825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0529"
FT                   /product="TAP domain protein"
FT                   /note="PFAM: TAP domain protein; alpha/beta hydrolase fold;
FT                   KEGG: rha:RHA1_ro01168 proteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97013"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCH1"
FT                   /inference="protein motif:PFAM:PF08386"
FT                   /protein_id="ADG97013.1"
FT                   /translation="MKEVFSVAAWGGAFLGKSGPRRARALAIVSATAAAAGVALVACPR
FT                   SASAPDMPEALKPFYDQQVVWGSCQGYVADFKPSPRTECAMVKVPVDYQNPKGESAQIA
FT                   VYRIKAAGQKIGSLLFNPGGPGGSGVGFVSGSASALVKLDIAQRFDLVGFDPRGIGHST
FT                   PSVHCLSDKEQDALRALNDNDYTPAGIARQETRNKDYAQKCAQRTGANFLAHVNSMDVA
FT                   RDMDVLRQALGDEKLNYVGYSYGTRIGTDYAELFPTHVRAMVLDGALDPNESPVDKLVN
FT                   QAKGFEDAFRIFAADCATQDHCPLGNDPAQADEKFRALVLPLIEHPVNTRDGRGLGYSD
FT                   AVLGTIQALYSKQLWVALREGLTEVKAGSGNILQLLSDLYMDRDSKSGHYSNEQDANIA
FT                   VRCVDDAPTTDRSVVDQMDVQGRKVAPFEDDERGTGHGALDPCAFWPVKPTIAPTISSP
FT                   PVGLPKIVVVSTTNDPATPYQAGVELAKQLGASLITYNGTQHTVSLQDQSQCVDNAVQQ
FT                   YLIDLKSPADGLTC"
     MKEVFSVAAW GGAFLGKSGP RRARALAIVS ATAAAAGVAL VACPRSASAP DMPEALKPFY        60
     DQQVVWGSCQ GYVADFKPSP RTECAMVKVP VDYQNPKGES AQIAVYRIKA AGQKIGSLLF       120
     NPGGPGGSGV GFVSGSASAL VKLDIAQRFD LVGFDPRGIG HSTPSVHCLS DKEQDALRAL       180
     NDNDYTPAGI ARQETRNKDY AQKCAQRTGA NFLAHVNSMD VARDMDVLRQ ALGDEKLNYV       240
     GYSYGTRIGT DYAELFPTHV RAMVLDGALD PNESPVDKLV NQAKGFEDAF RIFAADCATQ       300
     DHCPLGNDPA QADEKFRALV LPLIEHPVNT RDGRGLGYSD AVLGTIQALY SKQLWVALRE       360
     GLTEVKAGSG NILQLLSDLY MDRDSKSGHY SNEQDANIAV RCVDDAPTTD RSVVDQMDVQ       420
     GRKVAPFEDD ERGTGHGALD PCAFWPVKPT IAPTISSPPV GLPKIVVVST TNDPATPYQA       480
     GVELAKQLGA SLITYNGTQH TVSLQDQSQC VDNAVQQYLI DLKSPADGLT C                531
//

If you have problems or comments...

PBIL Back to PBIL home page