(data stored in ACNUC7421 zone)

EMBL: CP001958.PE522

CP001958.PE522       Location/Qualifiers
FT   CDS             507089..507973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0531"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: cai:Caci_4968
FT                   UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97015"
FT                   /db_xref="GOA:D6ZCH3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCH3"
FT                   /inference="protein motif:PFAM:PF01040"
FT                   /protein_id="ADG97015.1"
FT                   /translation="MLKERVRREISITLRLNINNIWVAMFPAVVFAAAGWVSNGSSSAT
FT                   EALKFLAALVWSYFFSYVFDAANQAVGCEEDVLNKPHRPIPHGLVDSRGLWARYRWASA
FT                   LFVAVSLVGNATTLAASLGWVLVTLFAHTQLKPRHYYLWKPVTTWLGVVAQLAGGWSFM
FT                   DDLASESIMWIVVVATMFIVAQPIEDVRDIAGDTRMGKVSLAYLFGAKKVCVAFCLIIA
FT                   AWPFLAYALFLHSSTLSPWEWGALLLLGALCGIAFHHAYQWNSLHHQRRAYIVYCFAYI
FT                   ALTLVPLSCLVSR"
     MLKERVRREI SITLRLNINN IWVAMFPAVV FAAAGWVSNG SSSATEALKF LAALVWSYFF        60
     SYVFDAANQA VGCEEDVLNK PHRPIPHGLV DSRGLWARYR WASALFVAVS LVGNATTLAA       120
     SLGWVLVTLF AHTQLKPRHY YLWKPVTTWL GVVAQLAGGW SFMDDLASES IMWIVVVATM       180
     FIVAQPIEDV RDIAGDTRMG KVSLAYLFGA KKVCVAFCLI IAAWPFLAYA LFLHSSTLSP       240
     WEWGALLLLG ALCGIAFHHA YQWNSLHHQR RAYIVYCFAY IALTLVPLSC LVSR             294
//

If you have problems or comments...

PBIL Back to PBIL home page