(data stored in ACNUC7421 zone)

EMBL: CP001958.PE523

CP001958.PE523       Location/Qualifiers
FT   CDS             507992..508561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0532"
FT                   /product="isopentenyl-diphosphate delta-isomerase, type 1"
FT                   /EC_number="5.3.3.2"
FT                   /note="TIGRFAM: isopentenyl-diphosphate delta-isomerase,
FT                   type 1; KEGG: nfa:nfa19790 isopentenyl-diphosphate delta-
FT                   isomerase; PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97016"
FT                   /db_xref="GOA:D6ZCH4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCH4"
FT                   /inference="protein motif:TFAM:TIGR02150"
FT                   /protein_id="ADG97016.1"
FT                   /translation="MESAFTKEESRWLMEFARGNVGTVDLVDAQGRSTGVRPVADAHRA
FT                   PGVLHRAFSVLLLRDGNEMLLQRRSVAKERWPGFWSNSCCGHPRSADTLVDDAKRRVFE
FT                   ELGIRVDALEHAGSFVYRATLREWTEHEYDHVLIGNMAGEDSLLRPDPKEIGELLWLPV
FT                   QDSLEALRQVTPWLPLVLEQVRARLA"
     MESAFTKEES RWLMEFARGN VGTVDLVDAQ GRSTGVRPVA DAHRAPGVLH RAFSVLLLRD        60
     GNEMLLQRRS VAKERWPGFW SNSCCGHPRS ADTLVDDAKR RVFEELGIRV DALEHAGSFV       120
     YRATLREWTE HEYDHVLIGN MAGEDSLLRP DPKEIGELLW LPVQDSLEAL RQVTPWLPLV       180
     LEQVRARLA                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page