(data stored in ACNUC7421 zone)

EMBL: CP001958.PE526

CP001958.PE526       Location/Qualifiers
FT   CDS             complement(511084..512133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mab:MAB_0706c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97019"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCH7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97019.1"
FT                   /translation="MRRIRPSANDAARRRPFRVAAMMLCAVVLTAGAGGCSADRSAEAR
FT                   AIGNAVRALPGVAAADVAYRSGASFRLDVTLAETASQTQAAAVGSTFVDRMRAGDFGGF
FT                   DVILNVAYPANSSRATKTSDSHASFQYHFRSAPENAASNPNPSSAEVASSLALWLQTAQ
FT                   SPATVGATVHQEALPGTNSRRSIVVSISSSVDDEAIAELIDAHPELRDATWKSSVPPGA
FT                   ARREFRVYRIHGQFPDRERRELWQQILERLGPDDDGDAVTDPAGAQASGALTNVKIDLW
FT                   AKPNTNERVEGITRAVVPLLPGLGSPVRVNIFSYTESVELILGGCSQPSPNHRPSALEA
FT                   ELRRQYERC"
     MRRIRPSAND AARRRPFRVA AMMLCAVVLT AGAGGCSADR SAEARAIGNA VRALPGVAAA        60
     DVAYRSGASF RLDVTLAETA SQTQAAAVGS TFVDRMRAGD FGGFDVILNV AYPANSSRAT       120
     KTSDSHASFQ YHFRSAPENA ASNPNPSSAE VASSLALWLQ TAQSPATVGA TVHQEALPGT       180
     NSRRSIVVSI SSSVDDEAIA ELIDAHPELR DATWKSSVPP GAARREFRVY RIHGQFPDRE       240
     RRELWQQILE RLGPDDDGDA VTDPAGAQAS GALTNVKIDL WAKPNTNERV EGITRAVVPL       300
     LPGLGSPVRV NIFSYTESVE LILGGCSQPS PNHRPSALEA ELRRQYERC                   349
//

If you have problems or comments...

PBIL Back to PBIL home page