(data stored in ACNUC7421 zone)

EMBL: CP001958.PE53

CP001958.PE53        Location/Qualifiers
FT   CDS             38249..40009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0053"
FT                   /product="protein of unknown function DUF1023"
FT                   /note="PFAM: protein of unknown function DUF1023; KEGG:
FT                   rop:ROP_19500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96546"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9L9"
FT                   /inference="protein motif:PFAM:PF06259"
FT                   /protein_id="ADG96546.1"
FT                   /translation="MAALGDLATSLASRASSLEEARAQFAKITQFPGWSGTAKDAAAGS
FT                   FQRADASLLDDVARVSAVHQAVLELSADFAQLQARVRELEREAASIGAVLGDDGKVTFP
FT                   EGAPWPDATQQHRALVIGGEAYELMTDADRLDEKAGEVLRKAVGGEINAAGTGNETQAA
FT                   LAGAAQGTLGMPEPPKAPGGHADPSYNAGWWKDLTPEQRRRVLDLHPEWVGNLDGVPAS
FT                   VHDEANRKMLPGDIARLQAEVDRLQKQLDSEFGHGAFSNTDSDLWYAQRRLEGLQATEK
FT                   ALRDNPGTKLLVLDPDYGTRGRVAIGTGDPDTANHISISTPGVNSSPGQSIGEMTKEAV
FT                   ALKTETENVLKANGHGNETVSTISWIGYEPPQAQLDPQHLDKTGDVGPGGLRDEPGGLS
FT                   DVASDAKAKAGAASLSQFYEGISAAWHPADGDSATSPHITALGHSYGSLTTSLALQQTQ
FT                   TGVVDNAVFYGSPGLELPSLDRLPVATGHAYSMQAPSDPINYVPNLTEHYGPNPVEIPG
FT                   ITRLSTEAGDTTGDAAPGTTVHHDGAHGHSEYPRKGDNGQLRMPGYNMSVIVAGMTGQD
FT                   GRPDLTKRGE"
     MAALGDLATS LASRASSLEE ARAQFAKITQ FPGWSGTAKD AAAGSFQRAD ASLLDDVARV        60
     SAVHQAVLEL SADFAQLQAR VRELEREAAS IGAVLGDDGK VTFPEGAPWP DATQQHRALV       120
     IGGEAYELMT DADRLDEKAG EVLRKAVGGE INAAGTGNET QAALAGAAQG TLGMPEPPKA       180
     PGGHADPSYN AGWWKDLTPE QRRRVLDLHP EWVGNLDGVP ASVHDEANRK MLPGDIARLQ       240
     AEVDRLQKQL DSEFGHGAFS NTDSDLWYAQ RRLEGLQATE KALRDNPGTK LLVLDPDYGT       300
     RGRVAIGTGD PDTANHISIS TPGVNSSPGQ SIGEMTKEAV ALKTETENVL KANGHGNETV       360
     STISWIGYEP PQAQLDPQHL DKTGDVGPGG LRDEPGGLSD VASDAKAKAG AASLSQFYEG       420
     ISAAWHPADG DSATSPHITA LGHSYGSLTT SLALQQTQTG VVDNAVFYGS PGLELPSLDR       480
     LPVATGHAYS MQAPSDPINY VPNLTEHYGP NPVEIPGITR LSTEAGDTTG DAAPGTTVHH       540
     DGAHGHSEYP RKGDNGQLRM PGYNMSVIVA GMTGQDGRPD LTKRGE                      586
//

If you have problems or comments...

PBIL Back to PBIL home page