(data stored in ACNUC7421 zone)

EMBL: CP001958.PE532

CP001958.PE532       Location/Qualifiers
FT   CDS             517178..518713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0541"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: msm:MSMEG_1517 SPFH
FT                   domain-containing protein/band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97025"
FT                   /db_xref="GOA:D6ZCI3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCI3"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ADG97025.1"
FT                   /translation="MRPVKTERNSLLMTIAIAVVVAVAWLVILLPLLYVKVPPNKVGVF
FT                   TGRGGKPKVIRGGGRLRLPGFERVDYLTLEPLSVRIKLDGALSGSGVPVNLEAVGMVSV
FT                   GASDEAVELAIRRFLGVDRLELRSQLNEILSGSLSEILARTTMEELNADREQLTRKLID
FT                   EASADLSRIGYTVDIVKIAALSDENGFLGSLGRRRIAEAKRDAFVGTAEAERDSNVQSA
FT                   QAKQAGAVAKAESDIAIAQAAQRRDVELAKLRAQVDTENALADQAGTLAETQARKDISI
FT                   AQEQAEAARIEASIAVQELRAEHAQAMLQADVIAFAEAEGQAAIKRAEGQHQAAVLQAE
FT                   SQAMATRKVGEAIADARRSAAQALLAEREAEASGLLALMQAEAEGLRVKLAAEAEGKKQ
FT                   VAEALNRYNSVGARLLALPDVLNALVAATEAASRPIAALDRVAANGNAAASLTALSSVS
FT                   PTVLANVLESFKASGVDLSEMIEDSAADAGASSAAEEESGLDIDLGLYQGAQS"
     MRPVKTERNS LLMTIAIAVV VAVAWLVILL PLLYVKVPPN KVGVFTGRGG KPKVIRGGGR        60
     LRLPGFERVD YLTLEPLSVR IKLDGALSGS GVPVNLEAVG MVSVGASDEA VELAIRRFLG       120
     VDRLELRSQL NEILSGSLSE ILARTTMEEL NADREQLTRK LIDEASADLS RIGYTVDIVK       180
     IAALSDENGF LGSLGRRRIA EAKRDAFVGT AEAERDSNVQ SAQAKQAGAV AKAESDIAIA       240
     QAAQRRDVEL AKLRAQVDTE NALADQAGTL AETQARKDIS IAQEQAEAAR IEASIAVQEL       300
     RAEHAQAMLQ ADVIAFAEAE GQAAIKRAEG QHQAAVLQAE SQAMATRKVG EAIADARRSA       360
     AQALLAEREA EASGLLALMQ AEAEGLRVKL AAEAEGKKQV AEALNRYNSV GARLLALPDV       420
     LNALVAATEA ASRPIAALDR VAANGNAAAS LTALSSVSPT VLANVLESFK ASGVDLSEMI       480
     EDSAADAGAS SAAEEESGLD IDLGLYQGAQ S                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page