(data stored in ACNUC7421 zone)

EMBL: CP001958.PE538

CP001958.PE538       Location/Qualifiers
FT   CDS             524517..525710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0547"
FT                   /product="translation elongation factor Tu"
FT                   /note="KEGG: mab:MAB_3848c elongation factor Tu; TIGRFAM:
FT                   translation elongation factor Tu; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain 2 protein; elongation factor Tu
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97031"
FT                   /db_xref="GOA:D6ZCI9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCI9"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ADG97031.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLHDKYPDLNE
FT                   ARDFAQIDNAPEERARGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGA
FT                   ILVVAATDGPMPQTREHVLLARQVGVPYILVALNKSDMVDDEEILELVELEVRELLSSN
FT                   EFDGDNAPVVRVSGLKALEGDQKWVDSVAELMQAVDENVPDPVRETDKPFLMAIEDVFT
FT                   ITGRGTVVTGRIERGVINVNEEVEIIGIKPTATKTTVTGVEMFRKLLDQGQAGDNVGLL
FT                   VRGIKREDVERGQVVIKPGTTTPHTEFEGTAYILNKEEGGRHTPFFNNYRPQFYFRTTD
FT                   VTGEVTLPEGKDMVMPGDNTDISVKLIQPVAMEEGQRFAIREGGRTVGAGRVTKINK"
     MAKAKFERTK PHVNIGTIGH VDHGKTTLTA AITKVLHDKY PDLNEARDFA QIDNAPEERA        60
     RGITINISHV EYQTEKRHYA HVDAPGHADY IKNMITGAAQ MDGAILVVAA TDGPMPQTRE       120
     HVLLARQVGV PYILVALNKS DMVDDEEILE LVELEVRELL SSNEFDGDNA PVVRVSGLKA       180
     LEGDQKWVDS VAELMQAVDE NVPDPVRETD KPFLMAIEDV FTITGRGTVV TGRIERGVIN       240
     VNEEVEIIGI KPTATKTTVT GVEMFRKLLD QGQAGDNVGL LVRGIKREDV ERGQVVIKPG       300
     TTTPHTEFEG TAYILNKEEG GRHTPFFNNY RPQFYFRTTD VTGEVTLPEG KDMVMPGDNT       360
     DISVKLIQPV AMEEGQRFAI REGGRTVGAG RVTKINK                                397
//

If you have problems or comments...

PBIL Back to PBIL home page