(data stored in ACNUC7421 zone)

EMBL: CP001958.PE54

CP001958.PE54        Location/Qualifiers
FT   CDS             40017..40673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0054"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mul:MUL_2139 lipoprotein LppV"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96547"
FT                   /db_xref="GOA:D6Z9M0"
FT                   /db_xref="InterPro:IPR032018"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9M0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96547.1"
FT                   /translation="MTYPVEKRSWLRRRAAWLWAAGVVVLVGVVLVCGVGVFRFVEVLK
FT                   GMDDAPRHMAQEKVPAFEERYRDKGSVQQAAEDLEAVIARAADKIAALVPGLTWKWQYD
FT                   PGNIGCPADAASDTRVTRFATRLAGFDGAIPEDVWPRAVAIVRSEAEFLGMTAQFKYQD
FT                   AAKQHDLVFSSQDGGEIRIATAVEAFIRGKTPCRLMEDWYTDRNIPIPGTGKEPR"
     MTYPVEKRSW LRRRAAWLWA AGVVVLVGVV LVCGVGVFRF VEVLKGMDDA PRHMAQEKVP        60
     AFEERYRDKG SVQQAAEDLE AVIARAADKI AALVPGLTWK WQYDPGNIGC PADAASDTRV       120
     TRFATRLAGF DGAIPEDVWP RAVAIVRSEA EFLGMTAQFK YQDAAKQHDL VFSSQDGGEI       180
     RIATAVEAFI RGKTPCRLME DWYTDRNIPI PGTGKEPR                               218
//

If you have problems or comments...

PBIL Back to PBIL home page