(data stored in ACNUC7421 zone)

EMBL: CP001958.PE540

CP001958.PE540       Location/Qualifiers
FT   CDS             complement(528431..529162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0551"
FT                   /product="Isochorismatase"
FT                   /EC_number="3.3.2.1"
FT                   /note="KEGG: mab:MAB_4406 isochorismatase/phenazine
FT                   biosynthesis protein PhzD; PFAM: isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97033"
FT                   /db_xref="GOA:D6ZCJ1"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016291"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCJ1"
FT                   /inference="protein motif:PRIAM:3.3.2.1"
FT                   /protein_id="ADG97033.1"
FT                   /translation="MSGFRRRELLVAGSALAASSLAGVFGGSEAGADVRPTGSISYPLD
FT                   GLSIPKSLAPWGLDRSRAVLLVHDMQHYFVKPYRLGSDPMKTVLANAKSLLDTARASGI
FT                   PVLYSGQPGGMTPEQRGLFLDLYGTGMPDDDAERAIVPPLERTSADVFITKSKISAFFH
FT                   TDLLDTLRSLGRDQLVIVGVYTFSGVAATSMDALQNDIETFIAADATADYTLDEHRQAL
FT                   AWCAARTARVVTAQSIATALR"
     MSGFRRRELL VAGSALAASS LAGVFGGSEA GADVRPTGSI SYPLDGLSIP KSLAPWGLDR        60
     SRAVLLVHDM QHYFVKPYRL GSDPMKTVLA NAKSLLDTAR ASGIPVLYSG QPGGMTPEQR       120
     GLFLDLYGTG MPDDDAERAI VPPLERTSAD VFITKSKISA FFHTDLLDTL RSLGRDQLVI       180
     VGVYTFSGVA ATSMDALQND IETFIAADAT ADYTLDEHRQ ALAWCAARTA RVVTAQSIAT       240
     ALR                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page