(data stored in ACNUC7421 zone)

EMBL: CP001958.PE541

CP001958.PE541       Location/Qualifiers
FT   CDS             complement(529307..530575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0552"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmi:MMAR_2797 sialic acid-transport integral membrane
FT                   protein NanT"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97034"
FT                   /db_xref="GOA:D6ZCJ2"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCJ2"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG97034.1"
FT                   /translation="MRKPSPWADLDRDQRSAFLASWLGWAMDAFDFFILTLVLNEIGQE
FT                   FHVSKRQLTFLITVTLVMRPLGAYLFGIWADKAGRRVPLMVNVCFYSTVGFLGAFAPNF
FT                   AVLVVLRLLYGIGMGGEWGIGAALTMEKVPPGKRGFFSGILQAGYASGFLFASVAHLFL
FT                   HSCLGLSWRWLFGLSILPALISLIVRAFVKESEVWVSTQEKMRAHGSSVRAVFFDPAVL
FT                   RRFGYLILLMTAFTSLSHGTQDLYPTFLKETEHAGRALSSAVADWVMIVANAGAIIGGV
FT                   FFGSLSDRIGRRGVIVLGSLTTLPLLPLFTVPHNPWLLGLGMFLVQATTQGAWAAVPAH
FT                   LSELSPNAIRGFYPGVTYQLGNLCTSCNATLQTGMAAAWGYPVSFWVLVGAACVSLAAL
FT                   TWFGPHADGVDFTAQDEKETAFD"
     MRKPSPWADL DRDQRSAFLA SWLGWAMDAF DFFILTLVLN EIGQEFHVSK RQLTFLITVT        60
     LVMRPLGAYL FGIWADKAGR RVPLMVNVCF YSTVGFLGAF APNFAVLVVL RLLYGIGMGG       120
     EWGIGAALTM EKVPPGKRGF FSGILQAGYA SGFLFASVAH LFLHSCLGLS WRWLFGLSIL       180
     PALISLIVRA FVKESEVWVS TQEKMRAHGS SVRAVFFDPA VLRRFGYLIL LMTAFTSLSH       240
     GTQDLYPTFL KETEHAGRAL SSAVADWVMI VANAGAIIGG VFFGSLSDRI GRRGVIVLGS       300
     LTTLPLLPLF TVPHNPWLLG LGMFLVQATT QGAWAAVPAH LSELSPNAIR GFYPGVTYQL       360
     GNLCTSCNAT LQTGMAAAWG YPVSFWVLVG AACVSLAALT WFGPHADGVD FTAQDEKETA       420
     FD                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page