(data stored in ACNUC7421 zone)

EMBL: CP001958.PE543

CP001958.PE543       Location/Qualifiers
FT   CDS             complement(531855..532967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0554"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   mjl:Mjls_2593 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97036"
FT                   /db_xref="GOA:D6ZCJ4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCJ4"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADG97036.1"
FT                   /translation="MTQLSETVLEEPVAKTMQAVVCHGPQDYRVEEMPVPVPGPGEALI
FT                   RVEAVGICGSDLKCFQGAAKFWGDEGRAPWAHTGVIPGHEFVGRVVRIDEDASLRWGVK
FT                   LGDRVSAEQIVPCWECRFCRKGNYHMCVPHDIYGFRRGYNGAMATYMLFPAKSLVHKIS
FT                   GELAPEHAAFCEPLACSLHAVQRAHIRFDDVVVVAGCGPIGLGMIAGAKARNPQHIVAL
FT                   DMKPEKLELAARCGADTTVDISQNDPNGVVLELTEGLGADVYLEGTGHASAVPQGLKLL
FT                   RKQGKYIEYGVFRDAVAVDWTIISDDKELDVLGAHLGPNCWPTAIRMLESQSLPLDDIC
FT                   THQFPLTDFEKGFELVGDGSRSVKVSLIPS"
     MTQLSETVLE EPVAKTMQAV VCHGPQDYRV EEMPVPVPGP GEALIRVEAV GICGSDLKCF        60
     QGAAKFWGDE GRAPWAHTGV IPGHEFVGRV VRIDEDASLR WGVKLGDRVS AEQIVPCWEC       120
     RFCRKGNYHM CVPHDIYGFR RGYNGAMATY MLFPAKSLVH KISGELAPEH AAFCEPLACS       180
     LHAVQRAHIR FDDVVVVAGC GPIGLGMIAG AKARNPQHIV ALDMKPEKLE LAARCGADTT       240
     VDISQNDPNG VVLELTEGLG ADVYLEGTGH ASAVPQGLKL LRKQGKYIEY GVFRDAVAVD       300
     WTIISDDKEL DVLGAHLGPN CWPTAIRMLE SQSLPLDDIC THQFPLTDFE KGFELVGDGS       360
     RSVKVSLIPS                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page