(data stored in ACNUC7421 zone)

EMBL: CP001958.PE548

CP001958.PE548       Location/Qualifiers
FT   CDS             complement(538079..538474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0559"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: ppu:PP_1062 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97041"
FT                   /db_xref="GOA:D6ZCJ9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCJ9"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADG97041.1"
FT                   /translation="MDIIRVVAAVIIDAQGRFLVARKRGTAVFMQAGGKVEPDEAPLDA
FT                   LVRELDEELGVQIGPEHAQRLGVFEAPAAHEPAATVLAEVYRVACAQEPHAHAEIEEIA
FT                   WITPGADDQRAFAPLTELLLDQFRASA"
     MDIIRVVAAV IIDAQGRFLV ARKRGTAVFM QAGGKVEPDE APLDALVREL DEELGVQIGP        60
     EHAQRLGVFE APAAHEPAAT VLAEVYRVAC AQEPHAHAEI EEIAWITPGA DDQRAFAPLT       120
     ELLLDQFRAS A                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page