(data stored in ACNUC7421 zone)

EMBL: CP001958.PE549

CP001958.PE549       Location/Qualifiers
FT   CDS             538554..539252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0560"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein; KEGG: nfa:nfa45580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97042"
FT                   /db_xref="GOA:D6ZCK0"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCK0"
FT                   /inference="protein motif:PFAM:PF01903"
FT                   /protein_id="ADG97042.1"
FT                   /translation="MPPDQASLLLVAHGTRCAEGVAMFEDLRDKVAQLLPDAQVRLAYV
FT                   DVIGPTPEDALRELPGPVVIVPAFLASGYHVRIDLPEQVRRSGRSDTVTAPALGPDVAL
FT                   AEVMAERLTQAGWAGEGQVVLAVAGSNDPAAQAENQTTLRQLEAVLGASVLLGTIGQGS
FT                   PRIAQVVPSLPGPVFIAQYLLADGLFSRKLIDLAPQAKGRAGPLGTHPKVVQLVVRRYR
FT                   EGLAEPRPNV"
     MPPDQASLLL VAHGTRCAEG VAMFEDLRDK VAQLLPDAQV RLAYVDVIGP TPEDALRELP        60
     GPVVIVPAFL ASGYHVRIDL PEQVRRSGRS DTVTAPALGP DVALAEVMAE RLTQAGWAGE       120
     GQVVLAVAGS NDPAAQAENQ TTLRQLEAVL GASVLLGTIG QGSPRIAQVV PSLPGPVFIA       180
     QYLLADGLFS RKLIDLAPQA KGRAGPLGTH PKVVQLVVRR YREGLAEPRP NV               232
//

If you have problems or comments...

PBIL Back to PBIL home page