(data stored in ACNUC7421 zone)

EMBL: CP001958.PE552

CP001958.PE552       Location/Qualifiers
FT   CDS             complement(542395..543852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0563"
FT                   /product="condensation domain protein"
FT                   /note="PFAM: condensation domain protein; KEGG:
FT                   rer:RER_21220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97045"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCK3"
FT                   /inference="protein motif:PFAM:PF00668"
FT                   /protein_id="ADG97045.1"
FT                   /translation="MEFVELFDYPITPGRVTHWMAHAETVMRDWPVDPRPASFVHEAHL
FT                   RAYTLAKCETRESWIGTALEFEGELDHAAFARTLRLWADRHEVLRSQVELVDLSHPQTS
FT                   PLIRRTLPEGAADFVPIDVGDLHSATAVHRELSQQFDTIASPSRWPGYVFSTLERDDGT
FT                   FTVLFVADHSLLDGYSIYLLGNELVQLYRQVLVEAPDFTPEPAGDKDSYVDFSAEERVA
FT                   AQAVGPEHPAVRAWDAVLKDGGAVTFPLPLEDMRSHRGKVAQRGYMSWLLDSQLSEDFS
FT                   EACKAAGGNYQAGIIAALALSTKLTSDREQFSAVMPFHTRNHPRWAESLGWFVGVAPMT
FT                   VDLRMSDSFSSALPLAQQTQQTGRLIASVPYARVRELLGPTRDNSFLVSFINGFAIPGI
FT                   DQWQEWRLRGLRSKNYSDDEVALFFNRSPSGLVLCGRYPNTETASRNVHKYLSTFRRIV
FT                   VSVAETGEFALSGQKLAARAERLRQPA"
     MEFVELFDYP ITPGRVTHWM AHAETVMRDW PVDPRPASFV HEAHLRAYTL AKCETRESWI        60
     GTALEFEGEL DHAAFARTLR LWADRHEVLR SQVELVDLSH PQTSPLIRRT LPEGAADFVP       120
     IDVGDLHSAT AVHRELSQQF DTIASPSRWP GYVFSTLERD DGTFTVLFVA DHSLLDGYSI       180
     YLLGNELVQL YRQVLVEAPD FTPEPAGDKD SYVDFSAEER VAAQAVGPEH PAVRAWDAVL       240
     KDGGAVTFPL PLEDMRSHRG KVAQRGYMSW LLDSQLSEDF SEACKAAGGN YQAGIIAALA       300
     LSTKLTSDRE QFSAVMPFHT RNHPRWAESL GWFVGVAPMT VDLRMSDSFS SALPLAQQTQ       360
     QTGRLIASVP YARVRELLGP TRDNSFLVSF INGFAIPGID QWQEWRLRGL RSKNYSDDEV       420
     ALFFNRSPSG LVLCGRYPNT ETASRNVHKY LSTFRRIVVS VAETGEFALS GQKLAARAER       480
     LRQPA                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page