(data stored in ACNUC7421 zone)

EMBL: CP001958.PE553

CP001958.PE553       Location/Qualifiers
FT   CDS             544072..547149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0564"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: rer:RER_22180
FT                   ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97046"
FT                   /db_xref="GOA:D6ZCK4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCK4"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ADG97046.1"
FT                   /translation="MDRMSPRQLFEEPARLFQDLASGRRGPFMVRGGPGSGKTRLVVDL
FT                   ACHWAPQPGTVTVVLTSNRAAADRLRAQIHGRLLRASPQLALAKPLVRTTHSYAFALLE
FT                   ARARASGNPPPRLIPAAEQDATLRELAIDQAARWPEPLRAALGSMEFTAQLRSVFQRAA
FT                   QHGHGPEGLIALGTARARPEWVAAGRTWREYEQVMTLRGAVGMADPAASPGALDAAELL
FT                   GAALDAVAEDPDLLLHPLGKPGSRFVVFVDDAQHFDPQAARLSSLAARRADLAVCTVDP
FT                   DQSVFWFQGAQTGPGLWREAEQLRLGPSQRLSSSVAQLVAAVAPRSAPQVATCRESAGE
FT                   AQTRLYPTVAAQAEGVVEALCRAHARDQVPWSRMAVLVRSVPVLEPSLARAAALADVPL
FT                   RLAAMSGPLAANTAVSALLSLLKALARKALEPATALELLVSPIAGASVAQARSLRRLLR
FT                   AQEPDRPSLDLLAELVLGAREHDVPEPVLRLRRVWRAACEALGAPAPTVETVLWAAWSA
FT                   SGLEERLPEGDFAAVRALFAAARAQRAADAADAAAELARFAERVERERLPVSATLGDGG
FT                   GSDAVTLLSAHAAAGQEWDVVVVCGVQEGLWPGFSESSSLLGVDELAAALAGTPAEAKL
FT                   DARKQVLAQERRLLYLACSRAREQLLVTAVEGEGDLVPSRFLAPLAPLALRTQEHGPAE
FT                   RAAAAPPPAPATPWSSAGVVAELRALACGADQHRAQRAAAALAALAQAGVIGAHPKSWH
FT                   GLAEVSTSEPLAKDGSLTLSPSRVQQLLDCPLRWLFERAMPAAPGEAAAIGTAVHLLAS
FT                   VADRFPEDELQAALDAAARAADERSARPPWAAQRRREQLARLFAAFMAWRNASRGELTQ
FT                   VGVEIPVEMSVSGVTLRGRIDRLERTARGELVIVDLKTAATPRSAASVREDPQLACYQL
FT                   VVRMARDEPVAGGKLVYLGALRQETGAAEREQPALTEEEAAQWNSTIREAAAAAAGPQF
FT                   RARPNQHCGSCPGRRCCPALQSAPGAPLAGAAGGAR"
     MDRMSPRQLF EEPARLFQDL ASGRRGPFMV RGGPGSGKTR LVVDLACHWA PQPGTVTVVL        60
     TSNRAAADRL RAQIHGRLLR ASPQLALAKP LVRTTHSYAF ALLEARARAS GNPPPRLIPA       120
     AEQDATLREL AIDQAARWPE PLRAALGSME FTAQLRSVFQ RAAQHGHGPE GLIALGTARA       180
     RPEWVAAGRT WREYEQVMTL RGAVGMADPA ASPGALDAAE LLGAALDAVA EDPDLLLHPL       240
     GKPGSRFVVF VDDAQHFDPQ AARLSSLAAR RADLAVCTVD PDQSVFWFQG AQTGPGLWRE       300
     AEQLRLGPSQ RLSSSVAQLV AAVAPRSAPQ VATCRESAGE AQTRLYPTVA AQAEGVVEAL       360
     CRAHARDQVP WSRMAVLVRS VPVLEPSLAR AAALADVPLR LAAMSGPLAA NTAVSALLSL       420
     LKALARKALE PATALELLVS PIAGASVAQA RSLRRLLRAQ EPDRPSLDLL AELVLGAREH       480
     DVPEPVLRLR RVWRAACEAL GAPAPTVETV LWAAWSASGL EERLPEGDFA AVRALFAAAR       540
     AQRAADAADA AAELARFAER VERERLPVSA TLGDGGGSDA VTLLSAHAAA GQEWDVVVVC       600
     GVQEGLWPGF SESSSLLGVD ELAAALAGTP AEAKLDARKQ VLAQERRLLY LACSRAREQL       660
     LVTAVEGEGD LVPSRFLAPL APLALRTQEH GPAERAAAAP PPAPATPWSS AGVVAELRAL       720
     ACGADQHRAQ RAAAALAALA QAGVIGAHPK SWHGLAEVST SEPLAKDGSL TLSPSRVQQL       780
     LDCPLRWLFE RAMPAAPGEA AAIGTAVHLL ASVADRFPED ELQAALDAAA RAADERSARP       840
     PWAAQRRREQ LARLFAAFMA WRNASRGELT QVGVEIPVEM SVSGVTLRGR IDRLERTARG       900
     ELVIVDLKTA ATPRSAASVR EDPQLACYQL VVRMARDEPV AGGKLVYLGA LRQETGAAER       960
     EQPALTEEEA AQWNSTIREA AAAAAGPQFR ARPNQHCGSC PGRRCCPALQ SAPGAPLAGA      1020
     AGGAR                                                                  1025
//

If you have problems or comments...

PBIL Back to PBIL home page