(data stored in ACNUC7421 zone)

EMBL: CP001958.PE557

CP001958.PE557       Location/Qualifiers
FT   CDS             complement(551571..552830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0568"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmi:MMAR_0577 integral membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97050"
FT                   /db_xref="GOA:D6ZCK8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCK8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG97050.1"
FT                   /translation="MATDQPAPIGQKDQQPFPLGKLVLLSLCMLVVITVEVGPVGVLPH
FT                   IAADLRVPQSRAALLVSCYAITVVLASVPAIRLLDRFDRRQVLMLSMSAFAVSTAALAV
FT                   TRSLPLAVAARVIGGFGHAIFFGVGIDITHRLSPAKRMVPAVAIFFSGNVLALALAVPA
FT                   VAAAGGSGWRGTFLALAGSAGACVVAARLLLPALPSGKADAPPLAGGARRPFFPWPDRP
FT                   AATVCLFGLVWLTGHFLAFTLLRAELTAAGFPDRLAPALLMAYGIGTLAGTGLAGAVAT
FT                   HRLRGAIAVGFLLLCGAQLCLWSLLPSMWPSFAAAALWGIGFGAIPTLNSSAILHYSRV
FT                   SPDMTASMLSSACNIGISLGSFASGLVYQNLGHDSAFLLAAGIFVVGALATRSLHKDGP
FT                   REGLGLTRGARAEGPAQGPR"
     MATDQPAPIG QKDQQPFPLG KLVLLSLCML VVITVEVGPV GVLPHIAADL RVPQSRAALL        60
     VSCYAITVVL ASVPAIRLLD RFDRRQVLML SMSAFAVSTA ALAVTRSLPL AVAARVIGGF       120
     GHAIFFGVGI DITHRLSPAK RMVPAVAIFF SGNVLALALA VPAVAAAGGS GWRGTFLALA       180
     GSAGACVVAA RLLLPALPSG KADAPPLAGG ARRPFFPWPD RPAATVCLFG LVWLTGHFLA       240
     FTLLRAELTA AGFPDRLAPA LLMAYGIGTL AGTGLAGAVA THRLRGAIAV GFLLLCGAQL       300
     CLWSLLPSMW PSFAAAALWG IGFGAIPTLN SSAILHYSRV SPDMTASMLS SACNIGISLG       360
     SFASGLVYQN LGHDSAFLLA AGIFVVGALA TRSLHKDGPR EGLGLTRGAR AEGPAQGPR        419
//

If you have problems or comments...

PBIL Back to PBIL home page