(data stored in ACNUC7421 zone)

EMBL: CP001958.PE558

CP001958.PE558       Location/Qualifiers
FT   CDS             552968..554233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0569"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="TIGRFAM: UDP-galactopyranose mutase; KEGG:
FT                   rha:RHA1_ro04053 UDP-galactopyranose mutase; PFAM:
FT                   UDP-galactopyranose mutase-like; FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97051"
FT                   /db_xref="GOA:D6ZCK9"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCK9"
FT                   /inference="protein motif:TFAM:TIGR00031"
FT                   /protein_id="ADG97051.1"
FT                   /translation="MTKPICLMILIPWSAVAPLSSYDLVVVGSGFFGLTVAERAASELG
FT                   KRVLVLERRAHLGGNAWSEPEPETGIEVHKYGAHLFHTSNTAVWDYVRRFTEFTDYQHR
FT                   VFTKHAGQIYPLPFGLALFCQFFGRAFTPAEAKAFVAAQAAEAVGDPDENLENRAVSLI
FT                   GRPLYEAFVRDYTAKQWQTDPKELPAEIITRLPVRLTFDTRYFNDRFEGLPKDGYAAWL
FT                   TKMAEHPLIDVRADVDYFDVAERIREENPQAPVVYTGPLDRYFHWSAGALSWRTLDFET
FT                   EVLDVGDFQGAAVMNYADLDVPYTRIHEFRHFHPERDYPKGKTVVMREFSRFAARADEP
FT                   YYPVNSPADRAKLAVYRELAKREGAERRVLFGGRLGTYQYLDMHMAIASAMRMFENELR
FT                   PYFATGAWPGARSTAATQRGAV"
     MTKPICLMIL IPWSAVAPLS SYDLVVVGSG FFGLTVAERA ASELGKRVLV LERRAHLGGN        60
     AWSEPEPETG IEVHKYGAHL FHTSNTAVWD YVRRFTEFTD YQHRVFTKHA GQIYPLPFGL       120
     ALFCQFFGRA FTPAEAKAFV AAQAAEAVGD PDENLENRAV SLIGRPLYEA FVRDYTAKQW       180
     QTDPKELPAE IITRLPVRLT FDTRYFNDRF EGLPKDGYAA WLTKMAEHPL IDVRADVDYF       240
     DVAERIREEN PQAPVVYTGP LDRYFHWSAG ALSWRTLDFE TEVLDVGDFQ GAAVMNYADL       300
     DVPYTRIHEF RHFHPERDYP KGKTVVMREF SRFAARADEP YYPVNSPADR AKLAVYRELA       360
     KREGAERRVL FGGRLGTYQY LDMHMAIASA MRMFENELRP YFATGAWPGA RSTAATQRGA       420
     V                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page