(data stored in ACNUC7421 zone)

EMBL: CP001958.PE564

CP001958.PE564       Location/Qualifiers
FT   CDS             complement(560293..561381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0575"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   dba:Dbac_1649 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97057"
FT                   /db_xref="GOA:D6ZCL5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCL5"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG97057.1"
FT                   /translation="MVSASAKPSSIAAQGAFLRPAVESDRGFLREIFTTALSDYYGGDH
FT                   VAHADRVLAAHLRGGEDRHGHFSQAQDTQILATPGADQLGVLNCALKRQGTVKISPLIV
FT                   SPRAKSGAGLGRTLLLHAQQFALRRRARQIYCTVAETNAKALGFFRRHGFVVAGSAQDQ
FT                   YKDGVRELVLYKDLRPQHGRRSWIIRECEENDLPAVVGMVCEFYAPILADQSKQVALSL
FT                   VDGFRRRSRRDLNEKFKDINLGLDENGSLLALAAAGPKKGAAVKVAPLCGRDMEVLSEL
FT                   VALVPDLFPSQRSRYYTHQIAEPDITKVMHKNGWRVDCLLPGAYRSDQCVVQWSLTLGC
FT                   SPDESRPQDLRRAAPDEKAELA"
     MVSASAKPSS IAAQGAFLRP AVESDRGFLR EIFTTALSDY YGGDHVAHAD RVLAAHLRGG        60
     EDRHGHFSQA QDTQILATPG ADQLGVLNCA LKRQGTVKIS PLIVSPRAKS GAGLGRTLLL       120
     HAQQFALRRR ARQIYCTVAE TNAKALGFFR RHGFVVAGSA QDQYKDGVRE LVLYKDLRPQ       180
     HGRRSWIIRE CEENDLPAVV GMVCEFYAPI LADQSKQVAL SLVDGFRRRS RRDLNEKFKD       240
     INLGLDENGS LLALAAAGPK KGAAVKVAPL CGRDMEVLSE LVALVPDLFP SQRSRYYTHQ       300
     IAEPDITKVM HKNGWRVDCL LPGAYRSDQC VVQWSLTLGC SPDESRPQDL RRAAPDEKAE       360
     LA                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page