(data stored in ACNUC7421 zone)

EMBL: CP001958.PE567

CP001958.PE567       Location/Qualifiers
FT   CDS             562921..563232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa10720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97060"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCL8"
FT                   /inference="similar to AA sequence:KEGG:nfa10720"
FT                   /protein_id="ADG97060.1"
FT                   /translation="MPRRKPNAEPRKGRAPAPRPGPPSFRFATSEAGPDGEEEYVVVAV
FT                   PGAKAVKAYRCPGCDHEIGVGEPHVVAWPAFDASAGERRHWHRSCWQARGRRAPSRRR"
     MPRRKPNAEP RKGRAPAPRP GPPSFRFATS EAGPDGEEEY VVVAVPGAKA VKAYRCPGCD        60
     HEIGVGEPHV VAWPAFDASA GERRHWHRSC WQARGRRAPS RRR                         103
//

If you have problems or comments...

PBIL Back to PBIL home page