(data stored in ACNUC7421 zone)

EMBL: CP001958.PE57

CP001958.PE57        Location/Qualifiers
FT   CDS             41512..41895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0057"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hoh:Hoch_5303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96550"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9M3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96550.1"
FT                   /translation="MSDTTALPVKGRTLIVANLQTKKALQIGLGPEVTITSTLRVPDGF
FT                   GPNAPEPRQLHIAVGGDSEAVNSARAALSPEEGDMIAVQDNTDDSVPAWFALSRETITR
FT                   AADGQALWSIEGVSMYDLRRARA"
     MSDTTALPVK GRTLIVANLQ TKKALQIGLG PEVTITSTLR VPDGFGPNAP EPRQLHIAVG        60
     GDSEAVNSAR AALSPEEGDM IAVQDNTDDS VPAWFALSRE TITRAADGQA LWSIEGVSMY       120
     DLRRARA                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page