(data stored in ACNUC7421 zone)

EMBL: CP001958.PE572

CP001958.PE572       Location/Qualifiers
FT   CDS             566617..566994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0583"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="KEGG: sen:SACE_5755 phosphoribosyl-AMP
FT                   cyclohydrolase; PFAM: phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97065"
FT                   /db_xref="GOA:D6ZCM3"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCM3"
FT                   /inference="protein motif:PRIAM:3.5.4.19"
FT                   /protein_id="ADG97065.1"
FT                   /translation="MSESPAPGPAPALDPAVAARLKRNADGLVAAVVQRRGTGEVLMMA
FT                   WMDDEALARTLTSRRGTYFSRSRGRLWVKGETSGNTQEVVEVRLDCDGDTVLVVVDQTG
FT                   PSCHTGTSTCFDSDVLLRPKV"
     MSESPAPGPA PALDPAVAAR LKRNADGLVA AVVQRRGTGE VLMMAWMDDE ALARTLTSRR        60
     GTYFSRSRGR LWVKGETSGN TQEVVEVRLD CDGDTVLVVV DQTGPSCHTG TSTCFDSDVL       120
     LRPKV                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page