(data stored in ACNUC7421 zone)

EMBL: CP001958.PE573

CP001958.PE573       Location/Qualifiers
FT   CDS             567038..567568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0584"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sru:SRU_1782 aldehyde dehydrogenase (NAD)
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97066"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCM4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97066.1"
FT                   /translation="MSKTVLRTLALLFGAVLPLNVAPLALADDDDDDGEGASAPPYWNN
FT                   AGPVDPDDPVVVYSDQPTAEVDYEVTGTSRSADLFFGTPGGTLRHQGYVLPFRQKEVAW
FT                   PPVQFMPMFATIPAINDWIALPNGNSRRPGDHSLTGGTATCRIWVSGKLVQERSASGVN
FT                   HTAKCAVTVRFFQ"
     MSKTVLRTLA LLFGAVLPLN VAPLALADDD DDDGEGASAP PYWNNAGPVD PDDPVVVYSD        60
     QPTAEVDYEV TGTSRSADLF FGTPGGTLRH QGYVLPFRQK EVAWPPVQFM PMFATIPAIN       120
     DWIALPNGNS RRPGDHSLTG GTATCRIWVS GKLVQERSAS GVNHTAKCAV TVRFFQ           176
//

If you have problems or comments...

PBIL Back to PBIL home page