(data stored in ACNUC7421 zone)

EMBL: CP001958.PE577

CP001958.PE577       Location/Qualifiers
FT   CDS             570512..571222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0588"
FT                   /product="Domain of unknown function DUF1906"
FT                   /note="PFAM: Domain of unknown function DUF1906; KEGG:
FT                   mav:MAV_1648 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97070"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCM8"
FT                   /inference="protein motif:PFAM:PF08924"
FT                   /protein_id="ADG97070.1"
FT                   /translation="MTLDRRAVLRGAATLGVASALGLSAPRAHAAGGVLLDFAGAAPSP
FT                   AAIRGAGAIGTIRYVSDERNGPGKRSSKPVTRDQVQVSKAAGLVIVSCYQYGKNETADW
FT                   KGGQQAGLTHARRGVQLHLAAGGPAGAPIYACIDDDPSDAELQGPIRGYLLGWQQIVGP
FT                   NAVGVYGNPRTIDFCLRSGVGKWFWQHDYGNPGYRTHPAAHLHQRAASMQPQPVVGGTL
FT                   CDINDIIKPSFGAW"
     MTLDRRAVLR GAATLGVASA LGLSAPRAHA AGGVLLDFAG AAPSPAAIRG AGAIGTIRYV        60
     SDERNGPGKR SSKPVTRDQV QVSKAAGLVI VSCYQYGKNE TADWKGGQQA GLTHARRGVQ       120
     LHLAAGGPAG APIYACIDDD PSDAELQGPI RGYLLGWQQI VGPNAVGVYG NPRTIDFCLR       180
     SGVGKWFWQH DYGNPGYRTH PAAHLHQRAA SMQPQPVVGG TLCDINDIIK PSFGAW           236
//

If you have problems or comments...

PBIL Back to PBIL home page