(data stored in ACNUC7421 zone)

EMBL: CP001958.PE580

CP001958.PE580       Location/Qualifiers
FT   CDS             572247..573026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0591"
FT                   /product="Domain of unknown function DUF1906"
FT                   /note="PFAM: Domain of unknown function DUF1906; KEGG:
FT                   mpa:MAP2334c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97073"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCN1"
FT                   /inference="protein motif:PFAM:PF08924"
FT                   /protein_id="ADG97073.1"
FT                   /translation="MTLSRRNVLRGMGGAALAAGLVHAAPAWADPDDDADDPEDDAPRP
FT                   KRPGPVNWGLGKMLDYSAGVPAPEAIKAAGYLGSFCYVSDQAKGEEWMKAKPLTRPVAD
FT                   AMRASGLIIASVWQWGGQTTADWRRGHDAGVKAARRAITLHQAAGGPDHAAIYACVDDD
FT                   PTPDLWEDSIADYLRGFEEVIGHERLGVFCNPKTIDWCLDAGLGTYFWQHDWNNDTLAL
FT                   HPAAHLHQLPGRKPWVVQVDNVECDQTAVLNMAFGQW"
     MTLSRRNVLR GMGGAALAAG LVHAAPAWAD PDDDADDPED DAPRPKRPGP VNWGLGKMLD        60
     YSAGVPAPEA IKAAGYLGSF CYVSDQAKGE EWMKAKPLTR PVADAMRASG LIIASVWQWG       120
     GQTTADWRRG HDAGVKAARR AITLHQAAGG PDHAAIYACV DDDPTPDLWE DSIADYLRGF       180
     EEVIGHERLG VFCNPKTIDW CLDAGLGTYF WQHDWNNDTL ALHPAAHLHQ LPGRKPWVVQ       240
     VDNVECDQTA VLNMAFGQW                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page