(data stored in ACNUC7421 zone)

EMBL: CP001958.PE581

CP001958.PE581       Location/Qualifiers
FT   CDS             573150..573971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0592"
FT                   /product="Domain of unknown function DUF1906"
FT                   /note="PFAM: Domain of unknown function DUF1906; KEGG:
FT                   mbt:JTY_2540 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97074"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCN2"
FT                   /inference="protein motif:PFAM:PF08924"
FT                   /protein_id="ADG97074.1"
FT                   /translation="MVITMALSRRDVLRGLSAAPVLGLGAIAAPARADQESDNADGGLW
FT                   GLGTLVDFSARVPDPAAIKEAGHLGAVRYVSERRPTEPWMLAKPVTSDEVAGMREHGLA
FT                   VASVYQWGKNLTADWRGGYDGGVDAARRGVELHLAASGPADGVIYAALDDDPDRDAFDT
FT                   LIAPYLTAWRDVIGNERLGVYCNPKTIDWCLGAGLGTYFWQHDWGNPSGAEHAAANLHQ
FT                   LPNSKGNLRVIDGVPCDVSVILKPDYGQWGQANAALAASAEQAANDDPVSS"
     MVITMALSRR DVLRGLSAAP VLGLGAIAAP ARADQESDNA DGGLWGLGTL VDFSARVPDP        60
     AAIKEAGHLG AVRYVSERRP TEPWMLAKPV TSDEVAGMRE HGLAVASVYQ WGKNLTADWR       120
     GGYDGGVDAA RRGVELHLAA SGPADGVIYA ALDDDPDRDA FDTLIAPYLT AWRDVIGNER       180
     LGVYCNPKTI DWCLGAGLGT YFWQHDWGNP SGAEHAAANL HQLPNSKGNL RVIDGVPCDV       240
     SVILKPDYGQ WGQANAALAA SAEQAANDDP VSS                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page