(data stored in ACNUC7421 zone)

EMBL: CP001958.PE582

CP001958.PE582       Location/Qualifiers
FT   CDS             574021..574488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0593"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: ckp:ckrop_0509
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97075"
FT                   /db_xref="GOA:D6ZCN3"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCN3"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ADG97075.1"
FT                   /translation="MARGIRDVGLLLARLGFAFALLPHGWEKLHDIGFSGTADGFAKMG
FT                   VPFPEVAAGVSIAGEFASSILLALGLLTPIAGLVAVVAMLGAVFTAPKHFFTAGAAHMD
FT                   QGVVNLLDTHWAGSEAFVFAVAALALTVAGPGRFSVDKSLFGRPEWFAPRE"
     MARGIRDVGL LLARLGFAFA LLPHGWEKLH DIGFSGTADG FAKMGVPFPE VAAGVSIAGE        60
     FASSILLALG LLTPIAGLVA VVAMLGAVFT APKHFFTAGA AHMDQGVVNL LDTHWAGSEA       120
     FVFAVAALAL TVAGPGRFSV DKSLFGRPEW FAPRE                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page