(data stored in ACNUC7421 zone)

EMBL: CP001958.PE584

CP001958.PE584       Location/Qualifiers
FT   CDS             575400..575744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0595"
FT                   /product="putative aminotransferase"
FT                   /note="KEGG: mbt:JTY_2304 putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97077"
FT                   /db_xref="GOA:D6ZCN5"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCN5"
FT                   /inference="similar to AA sequence:KEGG:JTY_2304"
FT                   /protein_id="ADG97077.1"
FT                   /translation="MAGDPLSTNIERLRLFGQNVSDGSEQAESAGAGGLYGSVSLPGAE
FT                   TAQAAVDAAQAHRAVVGRLRGEYAYAGEETASDAARFQGHEEDHAARFRQTYDEIDQSA
FT                   TGLGAQSAEA"
     MAGDPLSTNI ERLRLFGQNV SDGSEQAESA GAGGLYGSVS LPGAETAQAA VDAAQAHRAV        60
     VGRLRGEYAY AGEETASDAA RFQGHEEDHA ARFRQTYDEI DQSATGLGAQ SAEA             114
//

If you have problems or comments...

PBIL Back to PBIL home page