(data stored in ACNUC7421 zone)

EMBL: CP001958.PE586

CP001958.PE586       Location/Qualifiers
FT   CDS             577585..578262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mav:MAV_1466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97079"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCN7"
FT                   /inference="similar to AA sequence:KEGG:MAV_1466"
FT                   /protein_id="ADG97079.1"
FT                   /translation="MNAAMKNSDIRVKGTTALLFSALVVAILAGCGGHEHTQSSAATPP
FT                   HHNDVTTLDMKPEPMTVSPNITSQRQAQETLYGYMQKTLQGLPDNIFLDNKRYGGYGGG
FT                   HTAACDSERVDRENSPVDFGDYRDMHTPPGSDYNALIAKVGDIWKSWGWRVEERDDDKP
FT                   NRYGHSPDGYTLSIQSAGAYEPTMVGGTPCFPASLRDDTVPQPRVISKDKLLYDEPSAA
FT                   PTR"
     MNAAMKNSDI RVKGTTALLF SALVVAILAG CGGHEHTQSS AATPPHHNDV TTLDMKPEPM        60
     TVSPNITSQR QAQETLYGYM QKTLQGLPDN IFLDNKRYGG YGGGHTAACD SERVDRENSP       120
     VDFGDYRDMH TPPGSDYNAL IAKVGDIWKS WGWRVEERDD DKPNRYGHSP DGYTLSIQSA       180
     GAYEPTMVGG TPCFPASLRD DTVPQPRVIS KDKLLYDEPS AAPTR                       225
//

If you have problems or comments...

PBIL Back to PBIL home page