(data stored in ACNUC7421 zone)

EMBL: CP001958.PE590

CP001958.PE590       Location/Qualifiers
FT   CDS             complement(581100..581411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0601"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_16880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97083"
FT                   /db_xref="InterPro:IPR021784"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCP1"
FT                   /inference="similar to AA sequence:KEGG:RER_16880"
FT                   /protein_id="ADG97083.1"
FT                   /translation="MSLPPTLRAIVQWLRAAYPQGIPEQDYVPLFALMPRKLSEGEIRQ
FT                   LAETLNENGRGAASSIDIGVLITKITNELPRAEDVDRIRQRLGDLVWEDEDGSGKTGA"
     MSLPPTLRAI VQWLRAAYPQ GIPEQDYVPL FALMPRKLSE GEIRQLAETL NENGRGAASS        60
     IDIGVLITKI TNELPRAEDV DRIRQRLGDL VWEDEDGSGK TGA                         103
//

If you have problems or comments...

PBIL Back to PBIL home page