(data stored in ACNUC7421 zone)

EMBL: CP001958.PE598

CP001958.PE598       Location/Qualifiers
FT   CDS             589045..590205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0609"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="KEGG: btr:Btr_2082 hypothetical protein; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97091"
FT                   /db_xref="GOA:D6ZCP9"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCP9"
FT                   /inference="protein motif:PRIAM:1.1.1.85"
FT                   /protein_id="ADG97091.1"
FT                   /translation="MAESENAAPRPEVAAPRPKAAMRRPKVAVLPGDGVGPEVLDAALP
FT                   VVEALGLDWELLFGEIGWTCWQRDGEPVPADTWRLIEDSDAGLLGAVTSKPEQEAQAEL
FT                   APRLRGAGRVYRSPVVQLRQRLDLYANLRPVVDYRAQPAQFDYVIVRENTEGLYAGFDV
FT                   AEVRGELWDLVRSHPNAARSGPDGVRVALRLQTDFGTDRILRFAFGLARAQGRSGVVVA
FT                   DKPNILRSSGGRLRERVERVAAEYPELRAEICNVDAVAMRLVTDPAGFGVIVAENVFGD
FT                   ILSDVAAGVAGSIGVAPSGNVGERWSYFEPVHGSAPDIAGRGIANPFGMILAVADLADH
FT                   LGAQAEAGAARRAVRAVMTRGEQVTADLGGSATTRQSARAVLACLV"
     MAESENAAPR PEVAAPRPKA AMRRPKVAVL PGDGVGPEVL DAALPVVEAL GLDWELLFGE        60
     IGWTCWQRDG EPVPADTWRL IEDSDAGLLG AVTSKPEQEA QAELAPRLRG AGRVYRSPVV       120
     QLRQRLDLYA NLRPVVDYRA QPAQFDYVIV RENTEGLYAG FDVAEVRGEL WDLVRSHPNA       180
     ARSGPDGVRV ALRLQTDFGT DRILRFAFGL ARAQGRSGVV VADKPNILRS SGGRLRERVE       240
     RVAAEYPELR AEICNVDAVA MRLVTDPAGF GVIVAENVFG DILSDVAAGV AGSIGVAPSG       300
     NVGERWSYFE PVHGSAPDIA GRGIANPFGM ILAVADLADH LGAQAEAGAA RRAVRAVMTR       360
     GEQVTADLGG SATTRQSARA VLACLV                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page