(data stored in ACNUC7421 zone)

EMBL: CP001958.PE600

CP001958.PE600       Location/Qualifiers
FT   CDS             591197..593149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0611"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="TIGRFAM: excinuclease ABC, C subunit; PFAM:
FT                   excinuclease ABC C subunit domain protein; Excinuclease ABC
FT                   C subunit domain protein; UvrB/UvrC protein; KEGG:
FT                   msm:MSMEG_3078 excinuclease ABC subunit C; SMART:
FT                   Excinuclease ABC C subunit domain protein;
FT                   Helix-hairpin-helix DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97093"
FT                   /db_xref="GOA:D6ZCQ1"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCQ1"
FT                   /inference="protein motif:TFAM:TIGR00194"
FT                   /protein_id="ADG97093.1"
FT                   /translation="MSYRPAAGAIPTEPGVYRFRDPSGQVIYVGKAKNLRARLSNYFQD
FT                   LYALAPRTRLMVTTASAVEWTVVATEVEALQLEFSWIKEFDPRFNVRYRDDKSYPMLAV
FT                   SLNEEYPRLFVYRGARRKGVRYFGPYSHVWAIRNTVDLLTKVFPARTCSNGVFKRHGQI
FT                   GRPCLLGYIDKCSAPCVGAVSAAEHRRIVQSFCEFLAGGADNLVRETRKRMLAAAEALD
FT                   FEAAARLRDELAALDKALEHQTVVLADGSDADVVAFDYDELEVAVQVFQVREGRVRGQR
FT                   GWVVDNAYSPGPHGDRTRDGRGWEAASRREMVEEFLLQFYGDLAELESVADRFGQSDRM
FT                   SAVPKEVLVPELPDDVEGFATWLSTLRGTPVALRVPRRGDKRKLMETVARNAHETLAQH
FT                   KLRRSGDFTERSAALQEIYEAFDLPAPPIRIECVDVSHVQGTDVVASLVVFDDGLPKKA
FT                   DYRHYTIKGAMGADGAPQNDDTRSVAEVIARRFAKRGDRPDPGLLVIDGGQPQVRAAHK
FT                   ALVELGAADIPVVGLAKRLEELWLPDDDDPVILPRRSPGLFLLQRVRDEAHRFAIAHHR
FT                   KKRSKRMTVSALDEVKGLGERRRAQLVKHFGSVRKLADASADEIAALPGFGPVLAESVV
FT                   TALAACQTPPQEASA"
     MSYRPAAGAI PTEPGVYRFR DPSGQVIYVG KAKNLRARLS NYFQDLYALA PRTRLMVTTA        60
     SAVEWTVVAT EVEALQLEFS WIKEFDPRFN VRYRDDKSYP MLAVSLNEEY PRLFVYRGAR       120
     RKGVRYFGPY SHVWAIRNTV DLLTKVFPAR TCSNGVFKRH GQIGRPCLLG YIDKCSAPCV       180
     GAVSAAEHRR IVQSFCEFLA GGADNLVRET RKRMLAAAEA LDFEAAARLR DELAALDKAL       240
     EHQTVVLADG SDADVVAFDY DELEVAVQVF QVREGRVRGQ RGWVVDNAYS PGPHGDRTRD       300
     GRGWEAASRR EMVEEFLLQF YGDLAELESV ADRFGQSDRM SAVPKEVLVP ELPDDVEGFA       360
     TWLSTLRGTP VALRVPRRGD KRKLMETVAR NAHETLAQHK LRRSGDFTER SAALQEIYEA       420
     FDLPAPPIRI ECVDVSHVQG TDVVASLVVF DDGLPKKADY RHYTIKGAMG ADGAPQNDDT       480
     RSVAEVIARR FAKRGDRPDP GLLVIDGGQP QVRAAHKALV ELGAADIPVV GLAKRLEELW       540
     LPDDDDPVIL PRRSPGLFLL QRVRDEAHRF AIAHHRKKRS KRMTVSALDE VKGLGERRRA       600
     QLVKHFGSVR KLADASADEI AALPGFGPVL AESVVTALAA CQTPPQEASA                  650
//

If you have problems or comments...

PBIL Back to PBIL home page