(data stored in ACNUC7421 zone)

EMBL: CP001958.PE602

CP001958.PE602       Location/Qualifiers
FT   CDS             594111..595100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0613"
FT                   /product="protein of unknown function UPF0052 and CofD"
FT                   /note="PFAM: protein of unknown function UPF0052 and CofD;
FT                   KEGG: rer:RER_30270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97095"
FT                   /db_xref="GOA:D6ZCQ3"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCQ3"
FT                   /inference="protein motif:PFAM:PF01933"
FT                   /protein_id="ADG97095.1"
FT                   /translation="MARRAAGRFAVAALGGGHGLFATLSAVRRLTPDVTAVVTVADDGG
FT                   SSGRLRQELDVIPPGDLRMALVALTPDDGDAGMWAQVLQHRFGGVGALAGHPVGNLLLA
FT                   GLAEVLGDPVAALDAMVRTFGAQGRVLPMSAVPLEIEAEVSGIEDDPRLIRRIRGQVAV
FT                   ATTPGKVRRVRLLPTEPPACAAAVGAIMRADLVVLGPGSWFSSVIPHVLVPEQLQALTA
FT                   TDARKVLVLNLAPEPGETAGFSTERHLHVLSQHAPGLRVDHIVVDAASVPDGADREQLV
FT                   RAADRFGASPTFARVAIPGTHQHDPEALAGVLKDLVGQDVPGQEDGGR"
     MARRAAGRFA VAALGGGHGL FATLSAVRRL TPDVTAVVTV ADDGGSSGRL RQELDVIPPG        60
     DLRMALVALT PDDGDAGMWA QVLQHRFGGV GALAGHPVGN LLLAGLAEVL GDPVAALDAM       120
     VRTFGAQGRV LPMSAVPLEI EAEVSGIEDD PRLIRRIRGQ VAVATTPGKV RRVRLLPTEP       180
     PACAAAVGAI MRADLVVLGP GSWFSSVIPH VLVPEQLQAL TATDARKVLV LNLAPEPGET       240
     AGFSTERHLH VLSQHAPGLR VDHIVVDAAS VPDGADREQL VRAADRFGAS PTFARVAIPG       300
     THQHDPEALA GVLKDLVGQD VPGQEDGGR                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page