(data stored in ACNUC7421 zone)

EMBL: CP001958.PE604

CP001958.PE604       Location/Qualifiers
FT   CDS             596086..597288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0615"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: bpy:Bphyt_4926 inosine/uridine-preferring
FT                   nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97097"
FT                   /db_xref="GOA:D6ZCQ5"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCQ5"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ADG97097.1"
FT                   /translation="MRVRSACAAILCAALLLAGLPSAAARAALVDSEPQKIIIIDTDFA
FT                   TMLDDGQVVSMAAQLHAEGQIDLLGVTVVTGDEWRDQEVAEAVRATERLGVGDPGPCRR
FT                   VPADFAVGVYPGADYPLDHGPAAVKADAAALATGDGFTGAWGTKKPVSRADLVAPPDGF
FT                   ATCARPRAQRAVDFMADQLRAFPHEITIVAIGPLTDLALLAKEHPDAVGLVKRIVIMGG
FT                   AFDVPGNSTAKAELNWWFDPKAADEVLKLPVEEVVTPLDLSNTVPLDDALYRRIAFPPS
FT                   PTPVTGLYRDIVGAGLDGKGGFDRDPDYTQPLWDELAFAYAVDPGFATESRVVWPTVRA
FT                   QLGENDGSVSYAPAPKPGRRPVTVITKFDNPRFDDWYVDLMTRPVPVRRQGASRLAQGN
FT                   H"
     MRVRSACAAI LCAALLLAGL PSAAARAALV DSEPQKIIII DTDFATMLDD GQVVSMAAQL        60
     HAEGQIDLLG VTVVTGDEWR DQEVAEAVRA TERLGVGDPG PCRRVPADFA VGVYPGADYP       120
     LDHGPAAVKA DAAALATGDG FTGAWGTKKP VSRADLVAPP DGFATCARPR AQRAVDFMAD       180
     QLRAFPHEIT IVAIGPLTDL ALLAKEHPDA VGLVKRIVIM GGAFDVPGNS TAKAELNWWF       240
     DPKAADEVLK LPVEEVVTPL DLSNTVPLDD ALYRRIAFPP SPTPVTGLYR DIVGAGLDGK       300
     GGFDRDPDYT QPLWDELAFA YAVDPGFATE SRVVWPTVRA QLGENDGSVS YAPAPKPGRR       360
     PVTVITKFDN PRFDDWYVDL MTRPVPVRRQ GASRLAQGNH                             400
//

If you have problems or comments...

PBIL Back to PBIL home page