(data stored in ACNUC7421 zone)

EMBL: CP001958.PE605

CP001958.PE605       Location/Qualifiers
FT   CDS             597336..598352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0616"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="TIGRFAM: glyceraldehyde-3-phosphate dehydrogenase,
FT                   type I; KEGG: nfa:nfa35890 glyceraldehyde-3-phosphate
FT                   dehydrogenase; PFAM: Glyceraldehyde 3-phosphate
FT                   dehydrogenase, NAD(P) binding domain; Glyceraldehyde
FT                   3-phosphate dehydrogenase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97098"
FT                   /db_xref="GOA:D6ZCQ6"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCQ6"
FT                   /inference="protein motif:TFAM:TIGR01534"
FT                   /protein_id="ADG97098.1"
FT                   /translation="MAIRVGVNGFGRIGRNFFRAAHAAKAAGRADFEIVAVNDLSDPAN
FT                   LAHLLKYDSILRRFPEEVSVDGQDILVGSQKIRALAVKEGPAALPWGDLGVDVVVESTG
FT                   IFTDAAKAKGHLDAGAKKVVISAPATGEDLTVVLGANEDKYDGSQKIISNASCTTNSIA
FT                   PVLKVIDEAFGIVRGGLTTVHAYTQDQNLQDGPHKDLRRARAAALNIVPTSTGAAKAIG
FT                   LVLPQLVGKLDGYALRVPTPTGSISDLTLDVEKEATADAVNAAVKAAAEGPLQGILKYS
FT                   TDPIVSGDIIGDPHSSIFDAPLTKVISGQIKVAAWYDNEWGYSSRLVDLITLIGKSL"
     MAIRVGVNGF GRIGRNFFRA AHAAKAAGRA DFEIVAVNDL SDPANLAHLL KYDSILRRFP        60
     EEVSVDGQDI LVGSQKIRAL AVKEGPAALP WGDLGVDVVV ESTGIFTDAA KAKGHLDAGA       120
     KKVVISAPAT GEDLTVVLGA NEDKYDGSQK IISNASCTTN SIAPVLKVID EAFGIVRGGL       180
     TTVHAYTQDQ NLQDGPHKDL RRARAAALNI VPTSTGAAKA IGLVLPQLVG KLDGYALRVP       240
     TPTGSISDLT LDVEKEATAD AVNAAVKAAA EGPLQGILKY STDPIVSGDI IGDPHSSIFD       300
     APLTKVISGQ IKVAAWYDNE WGYSSRLVDL ITLIGKSL                               338
//

If you have problems or comments...

PBIL Back to PBIL home page