(data stored in ACNUC7421 zone)

EMBL: CP001958.PE606

CP001958.PE606       Location/Qualifiers
FT   CDS             598370..599596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0617"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="KEGG: mgi:Mflv_3709 phosphoglycerate kinase; PFAM:
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97099"
FT                   /db_xref="GOA:D6ZCQ7"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCQ7"
FT                   /inference="protein motif:PRIAM:2.7.2.3"
FT                   /protein_id="ADG97099.1"
FT                   /translation="MAISTLDDLLAAGVSGRGVLVRSDLNVPLDGSKITDPGRIAASVP
FT                   TLKKLAEAGAKVVVAAHLGRPDGAPDPKYSLGPVAAELAERLGRHVQLAGDVVGQDALA
FT                   RSEGLTSGDVLLLENVRFDPRETSKDDSARQSLARDLVELVGEDGAFVSDGFGVVHRKQ
FT                   ASVYDVATLLPAYAGDLVAAEAAVLRRLTESPERPYAVVLGGSKVSDKLAVIEHLAPRV
FT                   DTLVIGGGMAFTFLLAQGHSVGGSLVQEDQVENAKSLLQRYGSVLKLPLDVVVADTFAA
FT                   DAQTQTVAADAIPDGWMGLDVGPASHRHFRQALSDAKTIFWNGPLGVFEFPAFAWGTRA
FT                   LAEAIVEETAKGAFSVVGGGDSAAAVRTLKLGEDDFSHISTGGGASLEFLEGKTLPGIA
FT                   VLDRSGQER"
     MAISTLDDLL AAGVSGRGVL VRSDLNVPLD GSKITDPGRI AASVPTLKKL AEAGAKVVVA        60
     AHLGRPDGAP DPKYSLGPVA AELAERLGRH VQLAGDVVGQ DALARSEGLT SGDVLLLENV       120
     RFDPRETSKD DSARQSLARD LVELVGEDGA FVSDGFGVVH RKQASVYDVA TLLPAYAGDL       180
     VAAEAAVLRR LTESPERPYA VVLGGSKVSD KLAVIEHLAP RVDTLVIGGG MAFTFLLAQG       240
     HSVGGSLVQE DQVENAKSLL QRYGSVLKLP LDVVVADTFA ADAQTQTVAA DAIPDGWMGL       300
     DVGPASHRHF RQALSDAKTI FWNGPLGVFE FPAFAWGTRA LAEAIVEETA KGAFSVVGGG       360
     DSAAAVRTLK LGEDDFSHIS TGGGASLEFL EGKTLPGIAV LDRSGQER                    408
//

If you have problems or comments...

PBIL Back to PBIL home page