(data stored in ACNUC7421 zone)

EMBL: CP001958.PE61

CP001958.PE61        Location/Qualifiers
FT   CDS             43082..43267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0061"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acr:Acry_0583 riboflavin biosynthesis protein
FT                   RibF"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96554"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9M7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96554.1"
FT                   /translation="MNETEPRATLTGPPTTSTIFYPANSEHPAFKIVLVEQAGAWEAES
FT                   VEILDRHPVQEPDSGT"
     MNETEPRATL TGPPTTSTIF YPANSEHPAF KIVLVEQAGA WEAESVEILD RHPVQEPDSG        60
     T                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page