(data stored in ACNUC7421 zone)

EMBL: CP001958.PE610

CP001958.PE610       Location/Qualifiers
FT   CDS             601811..604603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0621"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="KEGG: rer:RER_30340 phosphoenolpyruvate carboxylase;
FT                   PFAM: phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97103"
FT                   /db_xref="GOA:D6ZCR1"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCR1"
FT                   /inference="protein motif:PRIAM:4.1.1.31"
FT                   /protein_id="ADG97103.1"
FT                   /translation="MTDAVSLFDPNDPERVATEPLREDIRLLGRVLGEIICEQSGQHVF
FT                   DLVEHARTESFRVRRSEIDRAELADFFADVGVDEAIPVVRAFCQFLLLANLAEDIHTER
FT                   RRRVHVQSGEAAPDSTLAATWRKLDESRPDPDRVAAALADALVAPVITAHPTETRRRSV
FT                   FEAQGRITELMRYLDRTALDETERDEVVEELRRHVTALWQTAITRLSRVRIQDEIEMGL
FT                   RYYQASLLEMIPKLNLEVDRQLRERWPEARPASAPPVVRPGSWIGGDRDGNPNVDASVV
FT                   ERASRRASAVVLEHYLAELALLQNELSMSRRLVEVDDAVRQLAAQAGPSAEWRADEPYR
FT                   QALSWLRARLSSTAAAVAPGLVEGASDPEGAPAYPKPEAFLADLDVIDSSLRAHHGAAL
FT                   AEGRLAAVRAAVSSFGFHLQSLDLRQNSEVHEQVVAELLAWAGACREYTSLAEDEKVRL
FT                   LTAELSTRRPLVGPRAAFSEVTARELGINAVAAKIIAELGPAAIPNYIISMCTSVSDML
FT                   EVLLLLKEAGVYDPGAGAEPPSCPINVIPLFETIEDLRQSAATLVATLSVPLYRDLVAG
FT                   KGMAQEVMLGYSDSNKDGGYLAANWALYRAELDLVEAAKQTGVRLRLFHGRGGTVGRGG
FT                   GPSYSAILAQPPGAVAGSLRLTEQGEIIAAKYAEPRRAYRNLEILVAATLEASLLDTEG
FT                   LGEQAEEVYALFDDLAERARVAYSALVHETPGFVEYFLASTPVSEIGALNIGSRPASRK
FT                   PTASIRDLRAIPWVLAWSQSRVMLPGWYGVGTAFEQWAGDDPAKLAVLRDLNERWPFFR
FT                   AVLSNLAQVLAKSDLGLASRYAELVPDARVREQVFGAICAEHARTLKMHAAITGTDDLL
FT                   ADNAALKRSVYNRFPYLEPLNHLQVEFLRRYRAGDQSDRVRLGIHLTMNGLATALRNSG
FT                   "
     MTDAVSLFDP NDPERVATEP LREDIRLLGR VLGEIICEQS GQHVFDLVEH ARTESFRVRR        60
     SEIDRAELAD FFADVGVDEA IPVVRAFCQF LLLANLAEDI HTERRRRVHV QSGEAAPDST       120
     LAATWRKLDE SRPDPDRVAA ALADALVAPV ITAHPTETRR RSVFEAQGRI TELMRYLDRT       180
     ALDETERDEV VEELRRHVTA LWQTAITRLS RVRIQDEIEM GLRYYQASLL EMIPKLNLEV       240
     DRQLRERWPE ARPASAPPVV RPGSWIGGDR DGNPNVDASV VERASRRASA VVLEHYLAEL       300
     ALLQNELSMS RRLVEVDDAV RQLAAQAGPS AEWRADEPYR QALSWLRARL SSTAAAVAPG       360
     LVEGASDPEG APAYPKPEAF LADLDVIDSS LRAHHGAALA EGRLAAVRAA VSSFGFHLQS       420
     LDLRQNSEVH EQVVAELLAW AGACREYTSL AEDEKVRLLT AELSTRRPLV GPRAAFSEVT       480
     ARELGINAVA AKIIAELGPA AIPNYIISMC TSVSDMLEVL LLLKEAGVYD PGAGAEPPSC       540
     PINVIPLFET IEDLRQSAAT LVATLSVPLY RDLVAGKGMA QEVMLGYSDS NKDGGYLAAN       600
     WALYRAELDL VEAAKQTGVR LRLFHGRGGT VGRGGGPSYS AILAQPPGAV AGSLRLTEQG       660
     EIIAAKYAEP RRAYRNLEIL VAATLEASLL DTEGLGEQAE EVYALFDDLA ERARVAYSAL       720
     VHETPGFVEY FLASTPVSEI GALNIGSRPA SRKPTASIRD LRAIPWVLAW SQSRVMLPGW       780
     YGVGTAFEQW AGDDPAKLAV LRDLNERWPF FRAVLSNLAQ VLAKSDLGLA SRYAELVPDA       840
     RVREQVFGAI CAEHARTLKM HAAITGTDDL LADNAALKRS VYNRFPYLEP LNHLQVEFLR       900
     RYRAGDQSDR VRLGIHLTMN GLATALRNSG                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page