(data stored in ACNUC7421 zone)

EMBL: CP001958.PE611

CP001958.PE611       Location/Qualifiers
FT   CDS             604731..605198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0622"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_5984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97104"
FT                   /db_xref="GOA:D6ZCR2"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCR2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97104.1"
FT                   /translation="MQPLENYSDPESWLADLKTELSNLQEQGQRANEALQQAQGTGTAA
FT                   NGDVTVVVGQSGQVQSLKLNDKALHLGPTKLSEAILTALRKAQNNAIDAARDAVAGLIG
FT                   EEKAHEFLDRYRLPDDEEDLSPPDARLAAGDDLEDRPSASWVRKDDGHKRW"
     MQPLENYSDP ESWLADLKTE LSNLQEQGQR ANEALQQAQG TGTAANGDVT VVVGQSGQVQ        60
     SLKLNDKALH LGPTKLSEAI LTALRKAQNN AIDAARDAVA GLIGEEKAHE FLDRYRLPDD       120
     EEDLSPPDAR LAAGDDLEDR PSASWVRKDD GHKRW                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page