(data stored in ACNUC7421 zone)

EMBL: CP001958.PE614

CP001958.PE614       Location/Qualifiers
FT   CDS             606336..607472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0625"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; ribonuclease H; KEGG:
FT                   nfa:nfa16400 bifunctional RNase H/acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97107"
FT                   /db_xref="GOA:D6ZCR5"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR014636"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCR5"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADG97107.1"
FT                   /translation="MRVVIEADGGSRGNPGPAAFGAVVLDGDRVLAQRAEQIGHATNNV
FT                   AEYRGLIAGLEAAKELGASEVLVRMDSKLVVEQMSGRWKVKHEGMRELASRAAALSRAF
FT                   DAVRYTWVPREQNKRADALLNAVLDGKEINTGGAAPVAAPEPAPETAPAVAPGAQLSWA
FT                   PPKPVSTRLLLVRHGETEASREFRQCGRSDLPLTKEGLAQARAAARRLGARGAITQVYS
FT                   SPLSRATQTATAVADALGVRVRTDDRLVEMDFGEWEGLTGQQIQDRDPRLREQWLAEPA
FT                   TPAPGGESFAQAAARVEAFIADVVKEHPGEEIVLVSHVTPIKLVLKAALGSGWELLTRL
FT                   FLDVASLSVVEFAPGGRSSVRLVNDISHWDTSRWDLSR"
     MRVVIEADGG SRGNPGPAAF GAVVLDGDRV LAQRAEQIGH ATNNVAEYRG LIAGLEAAKE        60
     LGASEVLVRM DSKLVVEQMS GRWKVKHEGM RELASRAAAL SRAFDAVRYT WVPREQNKRA       120
     DALLNAVLDG KEINTGGAAP VAAPEPAPET APAVAPGAQL SWAPPKPVST RLLLVRHGET       180
     EASREFRQCG RSDLPLTKEG LAQARAAARR LGARGAITQV YSSPLSRATQ TATAVADALG       240
     VRVRTDDRLV EMDFGEWEGL TGQQIQDRDP RLREQWLAEP ATPAPGGESF AQAAARVEAF       300
     IADVVKEHPG EEIVLVSHVT PIKLVLKAAL GSGWELLTRL FLDVASLSVV EFAPGGRSSV       360
     RLVNDISHWD TSRWDLSR                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page