(data stored in ACNUC7421 zone)

EMBL: CP001958.PE616

CP001958.PE616       Location/Qualifiers
FT   CDS             609130..609408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0627"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB; KEGG: nca:Noca_1411
FT                   transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97109"
FT                   /db_xref="GOA:D6ZCR7"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCR7"
FT                   /inference="protein motif:PFAM:PF02467"
FT                   /protein_id="ADG97109.1"
FT                   /translation="MKDSLDITQQIFLAIAEEEGAGQWQENALCAQTDPEVFFPEKGGS
FT                   TREAKRICLNCEVKNDCLEFALQNDERFGIWGGLSERERRRLRRRLA"
     MKDSLDITQQ IFLAIAEEEG AGQWQENALC AQTDPEVFFP EKGGSTREAK RICLNCEVKN        60
     DCLEFALQND ERFGIWGGLS ERERRRLRRR LA                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page