(data stored in ACNUC7421 zone)

EMBL: CP001958.PE618

CP001958.PE618       Location/Qualifiers
FT   CDS             610102..610488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0629"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_21560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97111"
FT                   /db_xref="InterPro:IPR021888"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCR9"
FT                   /inference="similar to AA sequence:KEGG:RER_21560"
FT                   /protein_id="ADG97111.1"
FT                   /translation="MRIPRRCSRPGCKMPAVATLTYVYAESTAVVGPLATNAEPHAWDL
FT                   CEIHAQRITAPKGWAMMRCEGSFTPVHAEDDDLTALAEAVREAGRGERKGARLPAVAGA
FT                   GATGRRGHLRVVPDLADPSPAGDK"
     MRIPRRCSRP GCKMPAVATL TYVYAESTAV VGPLATNAEP HAWDLCEIHA QRITAPKGWA        60
     MMRCEGSFTP VHAEDDDLTA LAEAVREAGR GERKGARLPA VAGAGATGRR GHLRVVPDLA       120
     DPSPAGDK                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page