(data stored in ACNUC7421 zone)

EMBL: CP001958.PE619

CP001958.PE619       Location/Qualifiers
FT   CDS             610485..611882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0630"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="KEGG: nfa:nfa46250
FT                   phosphomannomutase/phosphoglucomutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97112"
FT                   /db_xref="GOA:D6ZCS0"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCS0"
FT                   /inference="protein motif:PRIAM:5.4.2.8"
FT                   /protein_id="ADG97112.1"
FT                   /translation="MTGAGRGGARSPEAIAVVVKAYDVRGVVGEQIDEGLIADLGAAFA
FT                   QLMRSEGATSLVIGHDMRDSSGPLSDAFARGALAQGLDVTSIGLASTDELYFASGVLDR
FT                   PGAMFTASHNPAKYNGVKLCRAGAKPVGKETGLGEISQALISGVRDTEGAAPGERSAKD
FT                   VLEDYAQYLRDLVGLARIRPLTVVVDAGNGMAGHTAPAVLGPIEGLTVIPMFFELDGNF
FT                   PNHEANPLDPKNIVDLQAKVRATGADLGLAFDGDADRCFVVDERGDAISPSAITALVAE
FT                   RSLEKSPGSVIIHNAIVSRAVPELVRERGGVPERTKVGHSFIKQRMAETGAVFGGEHSA
FT                   HYYFRDFWGADSGMLAALHVLAALGASDRTASELMDGYERYAASGEINSTVSDAKAAIG
FT                   RVLDGFAERATSVDELDGVTVDLGDGAWFNLRASNTEPLLRLNAEAADRANVDAITEEV
FT                   LTLIRGE"
     MTGAGRGGAR SPEAIAVVVK AYDVRGVVGE QIDEGLIADL GAAFAQLMRS EGATSLVIGH        60
     DMRDSSGPLS DAFARGALAQ GLDVTSIGLA STDELYFASG VLDRPGAMFT ASHNPAKYNG       120
     VKLCRAGAKP VGKETGLGEI SQALISGVRD TEGAAPGERS AKDVLEDYAQ YLRDLVGLAR       180
     IRPLTVVVDA GNGMAGHTAP AVLGPIEGLT VIPMFFELDG NFPNHEANPL DPKNIVDLQA       240
     KVRATGADLG LAFDGDADRC FVVDERGDAI SPSAITALVA ERSLEKSPGS VIIHNAIVSR       300
     AVPELVRERG GVPERTKVGH SFIKQRMAET GAVFGGEHSA HYYFRDFWGA DSGMLAALHV       360
     LAALGASDRT ASELMDGYER YAASGEINST VSDAKAAIGR VLDGFAERAT SVDELDGVTV       420
     DLGDGAWFNL RASNTEPLLR LNAEAADRAN VDAITEEVLT LIRGE                       465
//

If you have problems or comments...

PBIL Back to PBIL home page