(data stored in ACNUC7421 zone)

EMBL: CP001958.PE620

CP001958.PE620       Location/Qualifiers
FT   CDS             612084..613157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0631"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_63790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97113"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCS1"
FT                   /inference="similar to AA sequence:KEGG:ROP_63790"
FT                   /protein_id="ADG97113.1"
FT                   /translation="MVDLTNAPAAERAAMVLFEVAAHGGAQARAVAAAVAGGALDALES
FT                   IQPRALLSVAGSAEAAHGADVFALVAGDEWDVPVVRSARLPSWAGPLDVLLVVGSDPGD
FT                   PLLVEAVSTALRRGVTTVVSAPLEGPLQAAASGRALDLAPRLAGGDSFGFVQSLAAHIA
FT                   VARAVRSARGASLVDVAALADQIDQEIFSAHPSRPVFENPARALAERMRGRRVVLAGDG
FT                   PAAVAVARYGADALLRVAGEPAQATDLVTTLFAGERLGVGGLSADAALFHDPEFDGPLP
FT                   AAPRVFALSAERGRWEVEAQIRRLPDAESVVVDPIQPEPEIRRFPRQEEFADLPQLAVL
FT                   AQRLALASVYLRLGEEH"
     MVDLTNAPAA ERAAMVLFEV AAHGGAQARA VAAAVAGGAL DALESIQPRA LLSVAGSAEA        60
     AHGADVFALV AGDEWDVPVV RSARLPSWAG PLDVLLVVGS DPGDPLLVEA VSTALRRGVT       120
     TVVSAPLEGP LQAAASGRAL DLAPRLAGGD SFGFVQSLAA HIAVARAVRS ARGASLVDVA       180
     ALADQIDQEI FSAHPSRPVF ENPARALAER MRGRRVVLAG DGPAAVAVAR YGADALLRVA       240
     GEPAQATDLV TTLFAGERLG VGGLSADAAL FHDPEFDGPL PAAPRVFALS AERGRWEVEA       300
     QIRRLPDAES VVVDPIQPEP EIRRFPRQEE FADLPQLAVL AQRLALASVY LRLGEEH          357
//

If you have problems or comments...

PBIL Back to PBIL home page