(data stored in ACNUC7421 zone)

EMBL: CP001958.PE621

CP001958.PE621       Location/Qualifiers
FT   CDS             613157..614332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0632"
FT                   /product="mannose-6-phosphate isomerase, class I"
FT                   /EC_number="5.3.1.8"
FT                   /note="TIGRFAM: mannose-6-phosphate isomerase, class I;
FT                   KEGG: mab:MAB_3601c mannose-6-phosphate isomerase ManA;
FT                   PFAM: mannose-6-phosphate isomerase type I"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97114"
FT                   /db_xref="GOA:D6ZCS2"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCS2"
FT                   /inference="protein motif:TFAM:TIGR00218"
FT                   /protein_id="ADG97114.1"
FT                   /translation="MRKLHGQMRHYPWGSRTHLAELTGRLSPSAQPEAEIWYGAHPAEP
FT                   CALGDAGDDGERTLAATIAADPGLQLGGNVVRRFGAELPFLVKLLAAGEPLSLQAHPSA
FT                   AQAQAGFARENALGVALDDPKRNYKDPRHKPELLVALTRFEALAGFRDARQTLGQLERA
FT                   GLLAQLPEAVLLRDHDLRGLVERWLLMPVDEVARRVAAVRAAGHPVGADLAQRYPHDPG
FT                   VLVALLLHHIVLEPGEGLFVPAGVLHAYLGGLGVEVMANSDNVLRGGLTSKHVDVDELL
FT                   AVMDFAPIPQRQLVVRSEDSPASSQYPGLATEFRLRVTRLANGEAQRAPSGPALEPGPE
FT                   ILLCVSGEAEIETGGRRERITPGEAVWRPAHERDVDITARADATVVFRASV"
     MRKLHGQMRH YPWGSRTHLA ELTGRLSPSA QPEAEIWYGA HPAEPCALGD AGDDGERTLA        60
     ATIAADPGLQ LGGNVVRRFG AELPFLVKLL AAGEPLSLQA HPSAAQAQAG FARENALGVA       120
     LDDPKRNYKD PRHKPELLVA LTRFEALAGF RDARQTLGQL ERAGLLAQLP EAVLLRDHDL       180
     RGLVERWLLM PVDEVARRVA AVRAAGHPVG ADLAQRYPHD PGVLVALLLH HIVLEPGEGL       240
     FVPAGVLHAY LGGLGVEVMA NSDNVLRGGL TSKHVDVDEL LAVMDFAPIP QRQLVVRSED       300
     SPASSQYPGL ATEFRLRVTR LANGEAQRAP SGPALEPGPE ILLCVSGEAE IETGGRRERI       360
     TPGEAVWRPA HERDVDITAR ADATVVFRAS V                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page