(data stored in ACNUC7421 zone)

EMBL: CP001958.PE63

CP001958.PE63        Location/Qualifiers
FT   CDS             43751..45166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0063"
FT                   /product="Terminase"
FT                   /note="PFAM: Terminase; KEGG: bln:Blon_1811 phage
FT                   terminase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96556"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9M9"
FT                   /inference="protein motif:PFAM:PF03354"
FT                   /protein_id="ADG96556.1"
FT                   /translation="MARLSEVARHLVVPEGIVSTEWPRVRAKCSELGLGFDEWQDGLGR
FT                   LMFSKREDGLYACDTVVVSIPRQVGKTHVMMSALFALCLLRAGLTVLWTAHRVKTAKET
FT                   FGSMAALAARDSVRPLVAQVVRGRGDEAVLFVNGSRILFGAREAGFGRGFADVGVLAFD
FT                   EAQILGESALDDMLASQNVAENPLTLFMGTPPRPKDPGEAFTMFRQEALDGESEGTLYV
FT                   ELSADRGCDVEDREQWRKANPSYPHRTSERAMLRLRKNLLEDSFRREALGVWDEVSTHQ
FT                   AVVKDSVWRALRADGPESSVRPHALVVDMSHSREVSVGACWLDGDCAHVEEVWAGVSGS
FT                   ECVEWVAANVGRRVPVGVDSASPASSLVPELRRRGVRVVVTNASDMAKAFGMLMDRVAA
FT                   GSLSHANQESVNQAVAGARRRPIRDAGGYGLDRRDETANIAPLVAVMLSVLVAVTHGRR
FT                   KSVVSSGRGGFVL"
     MARLSEVARH LVVPEGIVST EWPRVRAKCS ELGLGFDEWQ DGLGRLMFSK REDGLYACDT        60
     VVVSIPRQVG KTHVMMSALF ALCLLRAGLT VLWTAHRVKT AKETFGSMAA LAARDSVRPL       120
     VAQVVRGRGD EAVLFVNGSR ILFGAREAGF GRGFADVGVL AFDEAQILGE SALDDMLASQ       180
     NVAENPLTLF MGTPPRPKDP GEAFTMFRQE ALDGESEGTL YVELSADRGC DVEDREQWRK       240
     ANPSYPHRTS ERAMLRLRKN LLEDSFRREA LGVWDEVSTH QAVVKDSVWR ALRADGPESS       300
     VRPHALVVDM SHSREVSVGA CWLDGDCAHV EEVWAGVSGS ECVEWVAANV GRRVPVGVDS       360
     ASPASSLVPE LRRRGVRVVV TNASDMAKAF GMLMDRVAAG SLSHANQESV NQAVAGARRR       420
     PIRDAGGYGL DRRDETANIA PLVAVMLSVL VAVTHGRRKS VVSSGRGGFV L                471
//

If you have problems or comments...

PBIL Back to PBIL home page