(data stored in ACNUC7421 zone)

EMBL: CP001958.PE70

CP001958.PE70        Location/Qualifiers
FT   CDS             49647..49955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0070"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: formin homology 2 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96563"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9N6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96563.1"
FT                   /translation="MGRIDWNREGFRELRKDPALVAHLKTIAEDAKRDLDAELHGAQTN
FT                   RGQREASGYRADVAVGRTRARGYVGTETARAMAHEQAHDSLLKWAFRNGGQSPKRKG"
     MGRIDWNREG FRELRKDPAL VAHLKTIAED AKRDLDAELH GAQTNRGQRE ASGYRADVAV        60
     GRTRARGYVG TETARAMAHE QAHDSLLKWA FRNGGQSPKR KG                          102
//

If you have problems or comments...

PBIL Back to PBIL home page