(data stored in ACNUC7421 zone)

EMBL: CP001958.PE72

CP001958.PE72        Location/Qualifiers
FT   CDS             50395..51042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0072"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spm:spyM18_1465 putative structural phage
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96565"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9N8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96565.1"
FT                   /translation="MTNPTTPATGKDYFGYGDVRNIFKPQPDSEKTVGGLFVGPKFIDV
FT                   AEALDLDAPVLESLKQAGYLTVEGIRVKQDRPGKAINAFGGDELDYGQTSFSLTVAFDV
FT                   LEYFNDDAQRLAYGKNNVTVTPATTSHGKRTLTKITAKQLDEVSLFILLVQGDKQARYL
FT                   APFARVTEVGEEKHVHDELVSTPLTARCFPYQGAVLHRNVDDGMKLPAGLAA"
     MTNPTTPATG KDYFGYGDVR NIFKPQPDSE KTVGGLFVGP KFIDVAEALD LDAPVLESLK        60
     QAGYLTVEGI RVKQDRPGKA INAFGGDELD YGQTSFSLTV AFDVLEYFND DAQRLAYGKN       120
     NVTVTPATTS HGKRTLTKIT AKQLDEVSLF ILLVQGDKQA RYLAPFARVT EVGEEKHVHD       180
     ELVSTPLTAR CFPYQGAVLH RNVDDGMKLP AGLAA                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page