(data stored in ACNUC7421 zone)

EMBL: CP001958.PE73

CP001958.PE73        Location/Qualifiers
FT   CDS             51039..51371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to armadillo repeat containing 9"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96566"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9N9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96566.1"
FT                   /translation="MSAAKGRGAKAEKPAPVPGDLDFDWSKVYPEGELFEYESGGVKVV
FT                   IPVFEKFSADWYRRNRRLSNEERFYLHLERSAKPETFEAADRLSHDGYAAWLTAWGEEM
FT                   MSQLGK"
     MSAAKGRGAK AEKPAPVPGD LDFDWSKVYP EGELFEYESG GVKVVIPVFE KFSADWYRRN        60
     RRLSNEERFY LHLERSAKPE TFEAADRLSH DGYAAWLTAW GEEMMSQLGK                  110
//

If you have problems or comments...

PBIL Back to PBIL home page